Lepirudin
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor.
Clinical data | |
---|---|
Trade names | Refludan |
AHFS/Drugs.com | Monograph |
Routes of administration | SQ or IV |
ATC code | |
Legal status | |
Legal status |
|
Pharmacokinetic data | |
Bioavailability | 100 |
Elimination half-life | ~1.3 hours |
Excretion | Renal |
Identifiers | |
| |
CAS Number | |
IUPHAR/BPS | |
DrugBank | |
ChemSpider |
|
UNII | |
KEGG | |
ChEBI | |
ChEMBL | |
CompTox Dashboard (EPA) | |
Chemical and physical data | |
Formula | C288H448N80O110S6 |
Molar mass | 6983.56 g·mol−1 |
(what is this?) (verify) |
Brand name: Refludan, Generic: Lepirudin rDNA for injection.
Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63.
Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.